PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000438.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 207aa    MW: 21673 Da    PI: 6.7954
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000438.1_g00019.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.67.5e-5822117297
                    NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                              reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk+yl
  Itr_sc000438.1_g00019.1  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYL 107
                              89************************************************************************************ PP

                    NF-YB  88 kkyrelegek 97 
                              +++r++egek
  Itr_sc000438.1_g00019.1 108 QRFRDMEGEK 117
                              ********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.3E-5519130IPR009072Histone-fold
SuperFamilySSF471132.64E-4124135IPR009072Histone-fold
PfamPF008086.2E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-205573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-207492No hitNo description
PRINTSPR006151.5E-2093111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MADSDNESGG HKDGHGGDIS QREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEDYV EPLKIYLQRF RDMEGEKSAM  120
AGRQEKDGGG GNGSFANMGN SGGGYVGGGD SGVFASGGMG SHAMMMGQHH GHLYGSGVYN  180
QMGGGGGSGK PGSGYIGSGP PAAGRPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4822112292Transcription factor HapC (Eurofung)
4g92_B4e-4822112292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003634760.11e-97PREDICTED: nuclear transcription factor Y subunit B-3
RefseqXP_010644567.11e-97PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotO233109e-79NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG51e-97D7UAG5_VITVI; Putative uncharacterized protein
TrEMBLA5C8J37e-91A5C8J3_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t014e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-79nuclear factor Y, subunit B3